티스토리 뷰
CRF (human, rat) [4011473/H-2435][CAS no. 86784-80-7]_Bachem - 코아사이언스
코피디 2023. 12. 19. 16:52CRF (human, rat)
Product # 4011473 / Size: 1mg, 5mg
CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRH plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRH.
Salt form: Acetate
Molecular weight: 4757.52
Chemical Formula: C₂₀₈H₃₄₄N₆₀O₆₃S₂
Storage Temperature: < -15°C
Synonyms: Corticorelin
One Letter code: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH₂
Source: Synthetic
Old Product Number: H-2435
* 본 상품은 오직 연구용으로만 사용 가능합니다. 인체 및 제품화에 사용하실 수 없습니다.

코아사이언스 coresciences BACHEM AG Switzerland korea distributor 한국 대리점 APIs active pharmaceutical ingredients biologically active peptides and biochemicals amino acid derivatives recombinant human epidermal growth factor
'연구용 시약' 카테고리의 다른 글
- Total
- Today
- Yesterday
- 오토클레이브백
- Funakoshi
- gradient gel
- 형광염색
- filter
- material science
- 조직절편제작
- 면역화학분석
- 파라핀 블럭
- 코아사이언스
- matrix-driven delivery pellet
- 바이오하자드백
- time release pellets
- 조직염색절편제작
- 고수용성 콘드로이틴
- 후나코시
- OPV
- 건스터바이오텍
- 조직절편
- allview PAGE buffer
- 콘드로이틴 황산 올리고당
- 미니멸균백
- solar cells
- 바이오헤저드백
- 막필터
- OLED
- 파라핀 블록
- 연속절편
- Sterlitech
- Coresciences
일 | 월 | 화 | 수 | 목 | 금 | 토 |
---|---|---|---|---|---|---|
1 | 2 | 3 | 4 | 5 | ||
6 | 7 | 8 | 9 | 10 | 11 | 12 |
13 | 14 | 15 | 16 | 17 | 18 | 19 |
20 | 21 | 22 | 23 | 24 | 25 | 26 |
27 | 28 | 29 | 30 | 31 |