티스토리 뷰

연구용 시약

CRF (human, rat) [4011473/H-2435][CAS no. 86784-80-7]_Bachem - 코아사이언스

코피디 2023. 12. 19. 16:52
 

CRF (human, rat)

Product # 4011473 / Size: 1mg, 5mg

 

CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRH plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRH.

​

Salt form: Acetate

Molecular weight: 4757.52

Chemical Formula: C₂₀₈H₃₄₄N₆₀O₆₃S₂

Storage Temperature: < -15°C

Synonyms: Corticorelin

One Letter code: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH₂

Source: Synthetic

Old Product Number: H-2435

 

* 본 상품은 오직 연구용으로만 사용 가능합니다. 인체 및 제품화에 사용하실 수 없습니다.

코아사이언스 coresciences BACHEM AG Switzerland korea distributor 한국 대리점 APIs active pharmaceutical ingredients biologically active peptides and biochemicals amino acid derivatives recombinant human epidermal growth factor

 

'연구용 시약' 카테고리의 다른 글

[ADC Linker/Peptide Linker] Azide-PEG8-Val-Cit-PABC-SN-38 [BP-29793][CAS no. -]_BroadPharm - 코아사이언스  (1) 2023.12.26
[ADC Linker/Peptide Linker] MC-Val-Cit-PAB-SN38 [BP-40210][CAS no. 1801838-28-7]_BroadPharm - 코아사이언스  (1) 2023.12.26
3-Oxohexanedioic Acid [AAA68931][CAS no. 689-31-6]_Biosynth - 코아사이언스  (0) 2023.12.14
Baricitinib Phosphate [326861][CAS no. 1187595-84-1 (phosphate)]_MedKoo Biosciences - 코아사이언스  (0) 2023.12.14
Olmesartan medoxomil [144689-63-4][CAS no. 144689-63-4]_BOC Sciences - 코아사이언스  (0) 2023.12.14