(주) 코아사이언스 Coresciences Inc.

Mouse TREM2(Triggering Receptor Expressed On Myeloid Cells 2) ELISA Kit Cat.# ELK6548 / Size: 48T, 96T Product name: Mouse TREM2(Triggering Receptor Expressed On Myeloid Cells 2) ELISA Kit Reactivity: Mouse Alternative Names: Trem2a; Trem2b; Trem2c; Triggering receptor expressed on monocytes 2 Assay Type: Sandwich Sensitivity: 6.5 pg/mL Standard: 1000 pg/mL Range: 15.63-1000 pg/mL Sample Type: s..

Mouse SORT1(Sortilin 1) ELISA Kit Cat.# ELK7455 / Size: 48T, 96T Product name: Mouse SORT1(Sortilin 1) ELISA Kit Reactivity: Mouse Alternative Names: NT3; Gp95; NTR3; 100 kDa NT receptor; Glycoprotein 95; Neurotensin receptor 3 Assay Type: Sandwich Sensitivity: 0.066 ng/mL Standard: 10 ng/mL Range: 0.16-10 ng/mL Sample Type: Tissue homogenates, cell lysates and other biological fluids Assay Leng..

Mouse NEFL(Neurofilament, Light Polypeptide) ELISA Kit Cat.# ELK6650 / Size: 48T, 96T Product name: Mouse NEFL(Neurofilament, Light Polypeptide) ELISA Kit Reactivity: Mouse Alternative Names: CMT1F; CMT2E; NF-L; NF68; NFL; 68 kDa neurofilament protein; Neurofilament triplet L protein Assay Type: Sandwich Sensitivity: 6.5 pg/mL Standard: 1000 pg/mL Range: 15.63-1000 pg/mL Sample Type: serum, plas..

Mouse NEF3(Neurofilament 3) ELISA Kit Cat.# ELK5380 / Size: 48T, 96T Product name: Mouse NEF3(Neurofilament 3) ELISA Kit Reactivity: Mouse Alternative Names: NEFM; NF-M; NFM; Neurofilament,Medium Polypeptide; 160 kDa neurofilament protein; Neurofilament triplet M protein Assay Type: Sandwich Sensitivity: 6.2 pg/mL Standard: 1000 pg/mL Range: 15.63-1000 pg/mL Sample Type: Serum, plasma, tissue ho..

Mouse GFAP(Glial Fibrillary Acidic Protein) ELISA Kit Cat.# ELK1628 / Size: 48T, 96T Reactivity: Mouse Alternative Names: Intermediate Filament Protein Assay Type: Sandwich Sensitivity: 24.9 pg/mL Standard: 4000 pg/mL Range: 62.5-4000 pg/mL Sample Type: serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids Assay Length: 3.5h Research Area: Infection..

Mouse APOE(Apolipoprotein E) ELISA Kit Cat.# ELK2007 / Size: 48T, 96T Reactivity: Mouse Alternative Names: Apo-E; AD2; Apoprotein; Alzheimer Disease 2(E4-Associated,Late Onset Assay Type: Sandwich Sensitivity: 6.7 ng/mL Standard: 1000 ng/mL Range: 15.63-1000 ng/mL Sample Type: serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids Assay Length: 3.5h ..

Microglia Activation and AMPA regulation in the Focus Focus Microglia Activation: new rat monoclonal Galectin-3 antibody Galectin-3, also referred as Gal-3 or Mac-2, is a β-galactosidase binding protein that is predominantly located in the cytoplasm and shuttles into the nucleus. In addition, it is secreted to the cell surface and into biological fluids. This protein is like a jack of all trades..

Anti-Mouse RNF40 (KIAA0661) Polyclonal Antibody, Rabbit Cat.# MKA0661AF / Size: 50 µg (250 µL) General information Cat. No. ：MKA0661AF Quantity ：50 µg (250 µL) Gene ：mouse ring finger protein 40 (mRNF40, mKIAA0661) Immunogen ：GX0759 (GST-fusion protein, 187 amino acids) EQNGRLLQQLREKDDANFKLMSERIKANQIHKLLREEKDELGEQVLGLKSQVDAQLLTVQKLEE KERALQGSLGGVEKELTLRSQALELNKRKAVEAAQLAEDLKVQLEHVQTRLREIQPCLAESR..