Mouse GFAP(Glial Fibrillary Acidic Protein) ELISA Kit Cat.# ELK1628 / Size: 48T, 96T Reactivity: Mouse Alternative Names: Intermediate Filament Protein Assay Type: Sandwich Sensitivity: 24.9 pg/mL Standard: 4000 pg/mL Range: 62.5-4000 pg/mL Sample Type: serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids Assay Length: 3.5h Research Area: Infection..
Mouse APOE(Apolipoprotein E) ELISA Kit Cat.# ELK2007 / Size: 48T, 96T Reactivity: Mouse Alternative Names: Apo-E; AD2; Apoprotein; Alzheimer Disease 2(E4-Associated,Late Onset Assay Type: Sandwich Sensitivity: 6.7 ng/mL Standard: 1000 ng/mL Range: 15.63-1000 ng/mL Sample Type: serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids Assay Length: 3.5h ..
Microglia Activation and AMPA regulation in the Focus Focus Microglia Activation: new rat monoclonal Galectin-3 antibody Galectin-3, also referred as Gal-3 or Mac-2, is a β-galactosidase binding protein that is predominantly located in the cytoplasm and shuttles into the nucleus. In addition, it is secreted to the cell surface and into biological fluids. This protein is like a jack of all trades..
Anti-Mouse RNF40 (KIAA0661) Polyclonal Antibody, Rabbit Cat.# MKA0661AF / Size: 50 µg (250 µL) General information Cat. No. :MKA0661AF Quantity :50 µg (250 µL) Gene :mouse ring finger protein 40 (mRNF40, mKIAA0661) Immunogen :GX0759 (GST-fusion protein, 187 amino acids) EQNGRLLQQLREKDDANFKLMSERIKANQIHKLLREEKDELGEQVLGLKSQVDAQLLTVQKLEE KERALQGSLGGVEKELTLRSQALELNKRKAVEAAQLAEDLKVQLEHVQTRLREIQPCLAESR..
Blood-brain barrier - not all barriers must be overcome The blood–brain barrier (BBB) is a highly selective semipermeable border of endothelial cells that prevents solutes in the circulating blood from non-selectively crossing into the extracellular fluid of the central nervous system where neurons reside. It thus decides which substances enter the protected area of the CNS and which do not. The..
Ultra Sensitive Mouse Insulin ELISA (10 Kit Pack) Cat. # 90082 / Size: 10 x 96 wells The 10-kit pack is an economical option for high-volume users of our Ultra Sensitive Mouse Insulin ELISA. Highlights: - Kits use only 5 µL sample - Dynamic range of 0.1- 64 ng/mL - High sensitivity (50 pg/mL) using 5µL sample - Ten individually packaged kits Product Specifications Catalog # 90082 Sample Size 5 µ..
안녕하세요! ELISA 등 면역학 기반 분석 시약 및 키트 전문제조사 Crystal Chem의 한국 수입/공급 전문업체 코아사이언스 입니다. 자세한 상품 정보는 아래 배너 이미지를 클릭하시거나 이메일 info@coresciences.co.kr 또는 전화 02-858-0328로 문의주세요. 감사합니다! coresciences 코아사이언스 Crystal Chem ELISA kit 면역학 효소면역흡착검사 분석 키트 시약 당뇨 비만 식품 알러지 과민반응 독성학 세포생물학 세포활성 분석 내분비학 신경생물학
New Products Problems with P2Y12 receptor staining - try our new mouse monoclonal antibody P2Y12 receptor (P2RY12) is a Gi – coupled purinoceptor and is of particular relevance for microglia in the central nervous system. It is highly expressed in processes and somata of surveilling microglia and plays a major role in microglial chemotaxis in response to local CNS injury. The expression is downr..
- Total
- Today
- Yesterday
- 면역화학분석
- 조직염색절편제작
- 파라핀 블록
- 콘드로이틴 황산 올리고당
- 미니멸균백
- 고수용성 콘드로이틴
- OPV
- 형광염색
- Funakoshi
- time release pellets
- allview PAGE buffer
- OLED
- 바이오헤저드백
- 연속절편
- 파라핀 블럭
- 오토클레이브백
- Sterlitech
- 건스터바이오텍
- Coresciences
- 바이오하자드백
- material science
- 후나코시
- 조직절편
- gradient gel
- 막필터
- filter
- matrix-driven delivery pellet
- 조직절편제작
- solar cells
- 코아사이언스
일 | 월 | 화 | 수 | 목 | 금 | 토 |
---|---|---|---|---|---|---|
1 | 2 | 3 | 4 | 5 | ||
6 | 7 | 8 | 9 | 10 | 11 | 12 |
13 | 14 | 15 | 16 | 17 | 18 | 19 |
20 | 21 | 22 | 23 | 24 | 25 | 26 |
27 | 28 | 29 | 30 | 31 |