GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) [4030663/H-6795][CAS no. 107444-51-9]_Bachem - 코아사이언스

GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat)

Product # 4030663 / Size: 0.5mg, 1g

PRODUCT DESCRIPTION

GLP-1 (7-36) amide is secreted from the lower small intestine and shows a strong insulinotropic effect. GLP-1 (7-36) amide is considered as the most important incretin hormone. Its action is mediated by receptors expressed by the endocrine pancreatic B-cells. Considerable interest has focused on the development of this peptide as a therapeutic strategy for non-insulin-dependent (type 2 ) diabetes mellitus and associated neuropathy.

 

Salt form: Trifluoroacetate

Molecular weight: 3297.68

Chemical Formula: C₁₄₉H₂₂₆N₄₀O₄₅

Storage Temperature: < -15°C

Synonyms: Preproglucagon (98-127) amide (human, bovine, guinea pig, mouse, rat)

One Letter code: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂

Source: Synthetic

Old Product Number: H-6795

​

Literatures

​

Pentadecapeptide BPC 157 enhances the growth hormone receptor expression in tendon fibroblasts

C.-H.Chang et al., Molecules, 19, 19066 (2014)

Glucagon-like peptide 1 (7-36) amide (GLP-1) and exendin-4 stimulate serotonin release in rat hypothalamus.

L.Brunetti et al., Peptides, 29, 1377 (2008)

Truncated glucagon-like peptide-1 (proglucagon 78-107 amide), an intestinal insulin-releasing peptide, has specific receptors on rat insulinoma cells (RIN 5AH).

C.Orskov and J.H.Nielsen, FEBS Lett., 229, 175 (1988)

Glucagon-like peptide 1 (GLP-1) as a new therapeutic approach for type 2-diabetes.

M.A.Nauck et al., Exp. Clin. Endocrinol. Diabetes, 105, 187 (1997)

Effects of glucagon-like peptide-1(7-36)amide on the concentrations of insulin and glucose in sheep.

P.A.Martin and A.Faulkner, Comp. Biochem. Physiol. Comp. Physiol., 105, 705 (1993)

Exon duplication and divergence in the human preproglucagon gene.

G.I.Bell et al., Nature, 304, 368 (1983)

Glucagon-like peptide-1 7-36: a physiological incretin in man.

B.Kreymann et al., Lancet, 2, 1300 (1987)

Glucagon-like peptide 1 (7-36) amide (GLP-1) and exendin-4 stimulate serotonin release in rat hypothalamus.

L.Brunetti et al., Peptides, 29, 1377 (2008)

Truncated glucagon-like peptide-1 interacts with exendin receptors on dispersed acini from guinea pig pancreas. Identification of a mammalian analogue of the reptilian peptide exendin-4.

J.-P.Raufman et al., J. Biol. Chem., 267, 21432 (1992)

The glucagon-like peptides: a double-edged therapeutic sword?

T.Perry and N.H.Greig, Trends Pharmacol. Sci., 24, 377 (2003)

Glucagon-like peptide 1 and gastric inhibitory polypeptide: potential applications in type 2 diabetes mellitus.

J.J.Meier et al., Biodrugs, 17, 93 (2003)

 

* 본 상품은 오직 연구용으로만 사용 가능합니다. 인체 및 제품화에 사용하실 수 없습니다.

코아사이언스 coresciences BACHEM AG Switzerland korea distributor 한국 대리점 APIs active pharmaceutical ingredients biologically active peptides and biochemicals amino acid derivatives recombinant human epidermal growth factor